PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_93127g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 358aa    MW: 40148.3 Da    PI: 5.5424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_93127g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l ++++ +G g+W++ ++  g+ R++k+c++rw +yl
    MA_93127g0010 14 RGRWTAEEDEILTKYIQTHGEGSWRSLPQNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding53.17.4e-1772112648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +eE+el+++++++lG++ W++Ia +m+ gRt++++k++w+++l
    MA_93127g0010  72 KEEEELIIRLHTLLGNR-WSLIAGRMP-GRTDNEIKNYWNTHL 112
                      7****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-21563IPR009057Homeodomain-like
PROSITE profilePS5129415.603961IPR017930Myb domain
SuperFamilySSF466892.64E-2811108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-151461IPR001005SANT/Myb domain
CDDcd001673.16E-101661No hitNo description
PROSITE profilePS5129424.26562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-2464116IPR009057Homeodomain-like
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002494.4E-1472112IPR001005SANT/Myb domain
CDDcd001671.30E-1172112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRAPCCSKV GLNRGRWTAE EDEILTKYIQ THGEGSWRSL PQNAGLLRCG KSCRLRWINY  60
LRSDVKRGNI CKEEEELIIR LHTLLGNRWS LIAGRMPGRT DNEIKNYWNT HLSRKLANRG  120
IDTATHKPLG EVAEIFIQAK PSIITNVRNT SLNDIKPVRC SNIEASMVCS IDSALKKISK  180
KSSKKRSVWK EKQMPFEEQI PSGQSSSCES SCSGNLSSPD LLMAACCNPP SCDQVKKLSF  240
EKTPCQDRST DHVLYREIKE EDCNSDDPVN SSKLWEESFN SINILNSDME NMMFGYLETE  300
VELFGCLADP PMPAPNADEG NMETLSSDAD YNTEDELWST FLSNSEKTTL PSPSSLSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211625128MYB TRANSFORMING PROTEIN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU1312230.0KU131223.1 Picea abies transcription factor MYB34 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-70myb domain protein 4